PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540497.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 441aa    MW: 47635.1 Da    PI: 5.9218
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540497.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-16108154148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  KN540497.1_FGP002 108 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 154
                        688*****************************.************996 PP

2Myb_DNA-binding52.89.2e-17162202345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         WT+eEd  l++a++ +G+  W++Ia++++ gR+++ +k++w+
  KN540497.1_FGP002 162 IWTEEEDRMLIEAHQTYGNS-WSAIAKRLP-GRSENTIKNHWN 202
                        6*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.893103158IPR017930Myb domain
SuperFamilySSF466894.41E-31105201IPR009057Homeodomain-like
SMARTSM007174.9E-16107156IPR001005SANT/Myb domain
PfamPF002491.5E-15108154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-25110159IPR009057Homeodomain-like
CDDcd001677.94E-16111154No hitNo description
SMARTSM007174.8E-17159207IPR001005SANT/Myb domain
PROSITE profilePS5129417.517159209IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-22160206IPR009057Homeodomain-like
PfamPF002499.3E-16163202IPR001005SANT/Myb domain
CDDcd001672.69E-14163205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MAAAGNSFLN QELVKAADGV SDWHLPSSSH GGTCHTNTRA APITVGVPDL GCPVSSIGVA  60
TSSSLTPKEG LATASYNSVV AFPVGATMVP QQQQTQAAGS NDNPGLVKGG WTREEDEVLR  120
QMVRHHGDRK WAEIAKSLPG RIGKQCRERW TNHLHPDIKK DIWTEEEDRM LIEAHQTYGN  180
SWSAIAKRLP GRSENTIKNH WNATKRSLNS KRRLRKKNSE QTVPGQPSLL ENYIRSCQHM  240
LPSEIALPPP APPAPFDISR YGNSGVIGAS PTLPVVQEPG TSTPPGLVMF LDLLNQAIPH  300
PPQPETMDLF NMTPEVSHLN TSGYCLQLDA GGNLYYGQLP APAPVQPHGI SSQELQDTPH  360
LSLYYPLSSF AGSHTDGTVE FDHQLSNPDG GHYGEEAGPS SVAAGGSANG MDDNDVVQMA  420
SNQFMMPSED EGILDLARWI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-421042103110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLQ8GVH90.0Q8GVH9_ORYSJ; Myb-like protein
STRINGLOC_Os07g12130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-47myb domain protein 98